PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009592986.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 204aa    MW: 23724.5 Da    PI: 7.5662
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009592986.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.58.6e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W +eEde lv  +++lG ++W++ a+  g++R++k+c++rw++yl
   XP_009592986.1 14 RGQWLEEEDESLVMIIAMLGERRWDALAKASGLRRSGKSCRLRWLNYL 61
                     899*******************************************97 PP

2Myb_DNA-binding51.52.3e-1670112448
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       T++E+ l++++ kq+G++ W++Ia+ ++ gRt++++k++w+++l
   XP_009592986.1  70 ITADEEHLIIQLQKQFGNK-WSKIAEQLP-GRTDNEIKNYWRSHL 112
                      59*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.47961IPR017930Myb domain
SuperFamilySSF466891.6E-2612108IPR009057Homeodomain-like
SMARTSM007174.0E-111363IPR001005SANT/Myb domain
PfamPF002491.9E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-201568IPR009057Homeodomain-like
CDDcd001676.46E-81761No hitNo description
PROSITE profilePS5129426.03762116IPR017930Myb domain
SMARTSM007172.9E-1466114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-2469115IPR009057Homeodomain-like
PfamPF002491.3E-1470112IPR001005SANT/Myb domain
CDDcd001671.20E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MASKLTMHQD ELRRGQWLEE EDESLVMIIA MLGERRWDAL AKASGLRRSG KSCRLRWLNY  60
LRPNLKHGHI TADEEHLIIQ LQKQFGNKWS KIAEQLPGRT DNEIKNYWRS HLRKKALKYE  120
QESFGSNTSN SEQQSSTLKS DTVPSSHSDD YFSGKGDCSS AYSLAYSSND TTLLDWIPSW  180
SYEQSRMEHH MYFCSSNLCF CYPP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-26111161105MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-251111655159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-251111655159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592986.11e-153PREDICTED: myb-related protein MYBAS1-like isoform X1
RefseqXP_009592987.11e-153PREDICTED: myb-related protein MYBAS1-like isoform X1
RefseqXP_009592988.11e-153PREDICTED: myb-related protein MYBAS1-like isoform X1
SwissprotQ53NK66e-49MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLK4D3H61e-112K4D3H6_SOLLC; Uncharacterized protein
STRINGSolyc10g083900.1.11e-112(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.13e-51myb domain protein 27